DPCstruct | MC2577
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 301 ± 41 aa |
| Standard deviation of domain lengths | 41.03 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 67.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.49 |
| Mean length-normalized TM-Score | 0.32 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 22.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A175W943 | 1-267 | MDTEIRNSVDSYPEHIADANRPPGLEEPLVNGAQPIPMSTFSIQPPLPARSFWKQKCSHSTMLRLYKEMFMCDSCKRWCEFGFVYLC… |
| A0A6A6EAY8 | 1-275 | MSIQCPALEGNQSSTQPKDNPHSSHAAPTMKARPVPPRRVAARLPNCTHITMDRVYGQQQHCQVCGRQPSIGFLYICRQDLKPTPSS… |
| A0A1L9RRV5 | 54-402 | None |
| A0A0U5GCN1 | 22-264 | None |
| A0A2I2GED2 | 37-359 | None |
| A0A7D8YGW6 | 19-365 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.