DPCstruct | MC25764
Metacluster Properties and Pfam Annotations
| Number of structural domains | 47 |
|---|---|
| Mean domain length (aa) | 221 ± 33 aa |
| Standard deviation of domain lengths | 33.18 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 88.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 23.80 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14027 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A397HDY1 | 79-312 | KLYKQVRHNEKTRTAGRMQDGPFRLRDGPLARAMDEIVGIAAQFQIRPEELERGTAEMINCAAYSAGAAQRPGKVPKIDFFIMHNIT… |
| A0A5C3P4G2 | 26-263 | PAEIRRLSALWQIDVYGGQAELDDKVEELLWTATLLLAGTGKRGRKPRLDFFLMHMVTATLFVPSLLNVIPSMESKATLLRAFVPVL… |
| A0A1L9TRH6 | 430-662 | None |
| A0A066VX08 | 14-234 | None |
| A0A820B1Y3 | 37-256 | None |
| A0A0C3C5L3 | 279-513 | None |
| A0A1B7MI15 | 2-151 | None |
| A0A135V9H4 | 169-385 | None |
| A0A2A9NRY2 | 220-482 | None |
| A0A369JK68 | 737-969 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.