DPCstruct | MC25760
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 303 ± 33 aa |
| Standard deviation of domain lengths | 32.85 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 72.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 28.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A4HQD9 | 326-619 | DVKIPQHVISNLKEELAVNIDDDLKKNLQVFNRKFDEQQRLLQHIEETVIRQGSRVISAFREGPHDRIYDPELRAIWKEMGWKLSVP… |
| A0A5C3NWX5 | 1-298 | MIDSCAAVRLGPTQELDYAQELQLLKAELNQNPLVAIRNNLESFERKFLILQRELIDEMRKFVVREGDRVISTVLSGPHDRINDPDL… |
| A0A0C9UH67 | 2-248 | None |
| A0A0C9U656 | 5-273 | None |
| A0A4Q2DKH2 | 124-483 | None |
| B8PAZ9 | 222-570 | None |
| A0A4R0RPL3 | 289-572 | None |
| A0A0L6WV73 | 1-327 | None |
| W4JXI8 | 195-507 | None |
| A0A1M2VGF6 | 345-619 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.