DPCstruct | MC25759
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 184 ± 34 aa |
| Standard deviation of domain lengths | 33.80 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 80.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 19.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C3NRH2 | 43-205 | MGQRHQVFLIARVRPHGAPPDHPGNRRCIAAFHHQWCRGCSPLIAMRRLVTLIKQPDNAAIVRAEVRDIEGKYGSHGAVEPRIPDIP… |
| R7GHC3 | 1-185 | MGQRSQIYIRIWDKDKENPKLYAKYYGWNFGERMISRARHGIEYIKSYMEYISLESTQEKINRMFDINFDMKDILLTSDIIKEWLEQ… |
| A0A4Z1KDD2 | 2-181 | None |
| A0A194VKL8 | 1-151 | None |
| A0A545WAX2 | 27-216 | None |
| A0A6A6XZM7 | 4-157 | None |
| A0A6H1ZYI4 | 1-176 | None |
| A0A5M3Z9Y8 | 360-658 | None |
| E3QXR9 | 1-261 | None |
| A0A3C1S926 | 1-211 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.