DPCstruct | MC25757
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 316 ± 49 aa |
| Standard deviation of domain lengths | 48.95 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 71.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 26.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A163JYH6 | 173-442 | RVPGSQLATKNQRDAIITMMGEHSCRHPIFNCLRSDLLQDEFQVMATQIHQRCAYEMYTFCRENDLDDAWAYLYRNWYSYCWWRKWA… |
| A0A5C3NLK7 | 2-342 | YTFCHHRGLAEAWGYLWTSWYSPQKWPLWARSPSERISRLRTTMTVEKHWQELKGDHLHHLLRPRIDQLTYILVHRVTPSCIARSGK… |
| F8Q9M5 | 104-384 | None |
| A0A219AP28 | 495-799 | None |
| A0A146HEV7 | 1-267 | None |
| A0A0C9U897 | 756-1084 | None |
| A0A4S4M861 | 4-299 | None |
| A0A0C9WXX8 | 172-493 | None |
| A0A177T330 | 284-622 | None |
| A0A2I1GRT4 | 1-214 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.