DPCstruct | MC25753
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 627 ± 49 aa |
| Standard deviation of domain lengths | 49.46 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 69.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 25.45 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F8XUC0 | 546-1141 | PSRFMLMEGEEPYSLQSQIKALTLVLATPGAVVGAAAPCGAGPAGPFDVREAWVHPTLERKWFLVQMVLAAELLLRLDATVRVGLLQ… |
| S8BYU0 | 84-724 | RIKTEDYSLGSQCRELFKILEERHVWLDFSRPEERIRLGSILYGNGEEKILLVLQILLSCELWARLQLLHKYEPEKLELEPLYFTPK… |
| A0A423XJU2 | 185-791 | None |
| G2XR52 | 1-546 | None |
| A0A4S8YTA1 | 315-873 | None |
| A0A225AY65 | 268-943 | None |
| B8MKJ1 | 313-1015 | None |
| A0A6G1I799 | 299-900 | None |
| A0A2T4BWC5 | 1-692 | None |
| F0UVK0 | 262-877 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.