DPCstruct | MC2575
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 90 ± 5 aa |
| Standard deviation of domain lengths | 4.63 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 73.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 36.75 |
| Pfam Score | 75.00 |
| Assigned Pfam label(s) | PF09070- CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A7BYW4 | 1-98 | MFHIFSRDSKRQANVETLTAFEESNKSFAILVEIVNQGLPFNIKDLPGPATLKTESDQRDGELRLVRRSNGTFTLHIWSPSSSQWNT… |
| A0A446M9B7 | 41-125 | VVRIWTTDNNRFCSDEELATYTDIISQYTLSRKTVGGLKLMDLPGVEALQVQGNTDGQTLIVREGDNGVAYSWNSKELKWDKVST |
| A0A5N5QV59 | 603-688 | None |
| A0A812XSY1 | 134-220 | None |
| A0A287I648 | 94-181 | None |
| B9FVA6 | 207-303 | None |
| A0A0R3P115 | 251-339 | None |
| H9ISK2 | 184-275 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.