DPCstruct | MC25749
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 225 ± 34 aa |
| Standard deviation of domain lengths | 34.49 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 65.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.37 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 20.87 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V1CHT0 | 7-197 | HAIGLQFLLSDVTVAQNTARQTLYLEDQFLPMKPCAARCIAYSTGGCGVDKLANVLGCPYAYCEKETGAPNDCYCRGDNQAPANSYL… |
| S8BQL8 | 13-265 | ILSIIILINPTAVAQDPIPVIESYKITNALSYNYLRTCGLCCLGVGFCYDAQRLTNVLACTVNSCLCRRADISTSALSYISSCVNSA… |
| A0A2T2PBE3 | 3-241 | None |
| A0A179FK83 | 1-195 | None |
| A0A7J6JET7 | 4-232 | None |
| A0A0U5GXE1 | 6-159 | None |
| A0A7C8JFI9 | 7-249 | None |
| A0A1L7WJB1 | 2-265 | None |
| A0A1L7XD95 | 60-297 | None |
| G0SA57 | 142-404 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.