DPCstruct | MC25746
Metacluster Properties and Pfam Annotations
| Number of structural domains | 106 |
|---|---|
| Mean domain length (aa) | 153 ± 21 aa |
| Standard deviation of domain lengths | 20.92 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 79.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.46 |
| Mean intra-cluster sequence similarity (%) | 13.42 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16541 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A559LIM8 | 2-125 | PIVGKTWAIQNLTRYCGEDGDGCDYNFIVEADGKTERCTIIRMPGSNAATESWANEPCTDGSNLRISWGYVTEPVPAFAVITAVRDK… |
| S8API6 | 6-158 | LLLPLFSLASTLRATPIVSSRSGGIYPAPAGTFQIADFSDGGIRYSSHAVVTFIIKDSATSLVANCTASNQAQPPVATTPYATACNV… |
| R1GJU4 | 1-129 | None |
| A0A194VHU8 | 35-233 | None |
| A0A194UUG8 | 18-129 | None |
| A0A395GVS7 | 1-184 | None |
| L7ITB5 | 3-150 | None |
| A0A3M7H2Q1 | 37-230 | None |
| W6YZR8 | 3-116 | None |
| A0A194XGX3 | 1-139 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.