DPCstruct | MC25745
Metacluster Properties and Pfam Annotations
| Number of structural domains | 106 |
|---|---|
| Mean domain length (aa) | 151 ± 26 aa |
| Standard deviation of domain lengths | 25.86 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 79.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 21.24 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0317 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B5JY16 | 50-201 | LDRMEWTSNFAHHIKALECDDSWNLEFDDKIDPKNPDPGWRTFMWCSSAWFKCSGCKRSWPSNNVMVAFHMRLMDKEGTVKVKRFRQ… |
| S8A8Z3 | 87-230 | KRKPKRRETPKIHYMFEKYHKKIEAQVQGILFSSVDREGDAEWETNIIGEFNCSNRRCKGRWHSGKIFTLIRKYNRADGQLGYNAQV… |
| A0A4U1FFQ1 | 16-174 | None |
| A0A6P7ZC07 | 11-167 | None |
| T5BSY1 | 90-238 | None |
| A0A7J7YI69 | 5-133 | None |
| A0A6A4VTR7 | 1-149 | None |
| A0A818S279 | 33-185 | None |
| H0XSS6 | 33-167 | None |
| Q2HBV0 | 16-132 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.