DPCstruct | MC2574
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 312 ± 55 aa |
| Standard deviation of domain lengths | 54.65 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 65.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.75 |
| Mean length-normalized TM-Score | 0.26 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 20.36 |
| Pfam Score | 50.00 |
| Assigned Pfam label(s) | PF08766- PF09649 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E1ZJ57 | 1-252 | MSVNEAAVRAAVKARKAYIIENLNTMTLKSCRQMLEADMGVESGTLKPFKDLLGSLIDNLLAKKVAAEKTQQEEEPGFSDKKKTKAA… |
| A0A6A7BVY1 | 1-298 | MQPSEDEIVRCLEQVTRKALANNEEITVNSARALAVKELGLDQDFFKDGAWRSRSKAVISAAAQDPNSPQVSKSRKRESKEAFGEKK… |
| A0A836E871 | 152-436 | None |
| W9YJU4 | 13-366 | None |
| I0Z880 | 2-245 | None |
| A0A383UVM8 | 1-247 | None |
| A0A5M3YM74 | 22-322 | None |
| A0A7S2S945 | 1-246 | None |
| A0A167FKL2 | 1-248 | None |
| M4BJP6 | 6-276 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.