DPCstruct | MC25739
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 172 ± 20 aa |
| Standard deviation of domain lengths | 20.41 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 87.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 17.93 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U0NYT6 | 1-219 | MKIKKTLLYLLPLCAMVSCNKYPDALLVPDEEPLNSSGIESTDNVADSDLFHQHISEGKVASLTYDPTLDYPKNRGLDFQKHYRQYE… |
| A0A3L9ZUA8 | 297-473 | FPAWLISNRVSTLTIDPAAVHYTTYGSSATFNSMWTNFKNAVSTQTPTTNRRYPQTMAITFTSDSTITLRVNYLNNAQTSTLSADYD… |
| U2HCZ5 | 286-443 | None |
| A0A6M1E4S4 | 281-453 | None |
| A0A5D8YLE6 | 227-392 | None |
| A0A358XT27 | 124-279 | None |
| A0A191TJB6 | 265-445 | None |
| A0A519X4X3 | 119-267 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.