DPCstruct | MC25735
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 75 ± 7 aa |
| Standard deviation of domain lengths | 7.46 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 32.52 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S9KAK6 | 39-107 | DSWQEFASELLKDAVAMRGLSYPQLSALLAEKGLDIAPKTLSRRINRGTFDAGFFLRCLTALGAETIDI |
| A0A6L7VL44 | 5-74 | DSPTMRETIHRLLRSQMALKGVDYNSLSQRLAMLGVAQTATNLRSKVNHGTLGAQLFIYIQFALGIDDLE |
| A0A832DTL8 | 2-71 | None |
| A0A2W5JY79 | 1-88 | None |
| A0A2W4TJI2 | 2-85 | None |
| A0A3N5YKZ0 | 2-68 | None |
| A0A160FQ87 | 1-93 | None |
| A0A4Q0GLL8 | 11-81 | None |
| A0A2D9P8F0 | 12-81 | None |
| A0A7Y6MVY6 | 2-70 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.