DPCstruct | MC25732
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 96 ± 14 aa |
| Standard deviation of domain lengths | 14.37 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 73.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.80 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 44.29 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A540VZ10 | 1-92 | MTSSNPSSTDPAPRPKRCTFSPEYKLRIVAEYDAAPEGEKGAVLRRERLYHSHVTEWRAARDAGALENLVDRRTSPARPKKSTAEVE… |
| A0A1A6BCL8 | 1-86 | MERPDPEVPERARRRRFTAKYKLEMLAAYDAAPEGEKGALLRREGLYSSHIVQWRQARDAGALAGLAVPRGRKRRDPQAERITRLE |
| A0A532DDM2 | 3-111 | None |
| A0A5R8N4K5 | 6-97 | None |
| A0A7V4HWL0 | 74-152 | None |
| A0A1W2FG06 | 10-92 | None |
| A0A2N2FDM3 | 28-141 | None |
| A0A2V9X4V3 | 11-121 | None |
| A0A7I7MLF9 | 6-105 | None |
| A0A7W9LYU4 | 1-68 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.