DPCstruct | MC25731
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 178 ± 34 aa |
| Standard deviation of domain lengths | 34.32 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 79.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 30.29 |
| Pfam Score | 93.75 |
| Assigned Pfam label(s) | PF03390- CL0236 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6D1GKT6 | 2-136 | IAFALIIFIAIYAEAIPVDMMGGLGIIIAFGWLLGAIGNAIPGLNKFGGATILAMLVPATLVLFDLIPQNSLDAVNMLMSEANFLDL… |
| A0A4R5MT80 | 12-164 | LFQKFIALHIGIIPMPLYLILTLGYVLLTMGNQMPDDMLGALGIMTLFSFILEEVGKHIPVLKSLGGKVLVVTFLPSYLVYQNWLPK… |
| A0A2Z6EWM3 | 19-172 | None |
| A0A197JCD0 | 291-470 | None |
| A0A380H071 | 16-169 | None |
| A0A6M1HT48 | 1-162 | None |
| A0A5J6V2Z3 | 24-231 | None |
| D4MSL2 | 26-200 | None |
| A0A2Z6EX05 | 17-212 | None |
| A0A256GA57 | 1-108 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.