DPCstruct | MC25727
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 454 ± 60 aa |
| Standard deviation of domain lengths | 59.56 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 70.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 18.04 |
| Pfam Score | 91.67 |
| Assigned Pfam label(s) | CL0123- CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A367KWL2 | 6-352 | IALEQSASIAEQLLQEFLKDNISEPRTEKLFYQAIETRSNHFGDALFLDPVSVISNTSSSKEKFDLELAVEKINLASFAHKAYKLED… |
| M7PKB1 | 2-464 | EGQITEKKRSENYVDENHEMSGVDEDYSEAFRKKTKLKRELNVLNHETFTQNLNTTHEESHARLEDIQQELASEFHPDLSMLEHLPT… |
| M2LCG7 | 9-410 | None |
| A0A5M3ZDN1 | 44-531 | None |
| B0XYT1 | 1-534 | None |
| A0A317XKN0 | 8-529 | None |
| S9W2U6 | 1-483 | None |
| A0A1Q8S4T8 | 13-445 | None |
| A0A3N4K4G4 | 19-477 | None |
| L8FM80 | 8-509 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.