DPCstruct | MC25726
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 284 ± 69 aa |
| Standard deviation of domain lengths | 69.41 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 84.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.66 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 28.50 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T3AEI5 | 18-224 | RQPFPNNPFFKAPLVLDEAAREMIWKRVFMDEEPIKVVSAELGIDIRRVAAVVRMKTVEKEWVNEGKKLATPYRKAIMSMLFLHKYR… |
| M7PC16 | 45-264 | SKKENRNLKSNDKKKIQNKKRFSEQSDYIKWLVDPMEGGQYIKPLSKAGTNFIHQKEYPYPLNPKFKPQPPLSLEARRNIGEKWKQG… |
| A0A383UQ21 | 2-440 | None |
| S3DSU8 | 49-405 | None |
| A0A1V8V5I5 | 2-346 | None |
| A0A0L0T1Z9 | 10-213 | None |
| A0A372QH01 | 1-202 | None |
| A0A146IHU2 | 10-308 | None |
| A0A5C3MAQ1 | 5-213 | None |
| A0A517L0M1 | 2-355 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.