DPCstruct | MC25725
Metacluster Properties and Pfam Annotations
| Number of structural domains | 288 |
|---|---|
| Mean domain length (aa) | 310 ± 69 aa |
| Standard deviation of domain lengths | 69.01 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 80.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.45 |
| Mean intra-cluster sequence similarity (%) | 13.55 |
| Pfam Score | 69.34 |
| Assigned Pfam label(s) | CL0192- CL0236- PF10505- PF04712 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A803R5J0 | 2-163 | ATAYIRHEPWEMGVHKRNGVVYLDVHKLPERPQSDFERRRCYWGYCFESLATEDPRRTDGEGIHHVDANVEYCSVIKTKLGAHRILM… |
| M7NJD4 | 30-299 | LDGLLLSLCEYERQHGFQRTFVDILTWRGILTRFLCTPFDRCTAWAVNIVRFQNTIFIEDHLETISLPTEQEARMRFWGYKFETLST… |
| A0A194UNA8 | 36-407 | None |
| A0A6A5WY68 | 140-505 | None |
| A0A7R9KWC7 | 292-654 | None |
| A0A6G1IEX3 | 121-501 | None |
| K7FR26 | 3-220 | None |
| A0A6J0NZ75 | 25-298 | None |
| U6KMJ9 | 187-558 | None |
| A0A7S4SDP3 | 260-535 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.