DPCstruct | MC25724
Metacluster Properties and Pfam Annotations
| Number of structural domains | 61 |
|---|---|
| Mean domain length (aa) | 192 ± 36 aa |
| Standard deviation of domain lengths | 36.46 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 78.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 32.88 |
| Pfam Score | 98.91 |
| Assigned Pfam label(s) | PF09783- PF08385 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K7G4G9 | 2-150 | ENSYLCGYLKIKGLTEEYPTLTTFFEGEIISKKHPFLTRKWDADEDVDRKHWGKFQAFYQYAKTFNSDDFDYEDLKNGDYVFMRWKE… |
| M7NHH8 | 50-234 | TLQTSFLRSGAYFIGTQQSGKALYEVSVNFQHVNPKDSFLCGYLHIQGLTKDNSSLTTYFEGEIIGPKYGFITKRPEWGSTEKIDLQ… |
| A0A1B0A5A6 | 12-197 | None |
| A0A438NBM7 | 86-315 | None |
| A0A1A9XH76 | 7-187 | None |
| A0A2C9K283 | 31-147 | None |
| A0A066W4M9 | 2-251 | None |
| A0A1R0GX81 | 15-144 | None |
| A0A2S5BCB2 | 2-219 | None |
| R7QNR0 | 21-235 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.