DPCstruct | MC25721
Metacluster Properties and Pfam Annotations
| Number of structural domains | 50 |
|---|---|
| Mean domain length (aa) | 147 ± 15 aa |
| Standard deviation of domain lengths | 14.52 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 21.29 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14340 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N9YCI5 | 1-105 | MLLDPRGPRFAAVLTTVVLAIVLVTGAGLLLLAQAVVFALTAVNARLGPYGLLFRALVAPRLDPPAELEPVAPVRFAQVVGLVFSAV… |
| A0A171C861 | 1-126 | MQADPRALRFAATVTAAVLALVLVTDSVWLLAAQTAVFALGAVGASPYGMVFKGIVKSPPRDLEDARPPRFAQLVGLAFALAALVGH… |
| A0A0S7X0P3 | 2-141 | None |
| A0A534ZVR8 | 43-189 | None |
| A0A535VUE5 | 3-153 | None |
| A0A6J6Q8X5 | 2-137 | None |
| A0A7J9YXI3 | 78-224 | None |
| A0A3L7YJV7 | 2-156 | None |
| A0A6L6EBQ3 | 5-143 | None |
| A0A536HUN1 | 1-125 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.