DPCstruct | MC2572
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 163 ± 15 aa |
| Standard deviation of domain lengths | 15.05 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 75.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 20.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A416R0N2 | 2-185 | KCFNHEDREAAATCQRCGKGLCRECASKYTPCLCDDCFEAIQNENHARKVAELEQRKQSRLDKLSFTRWDLMLNCLLGAPFAIYTIY… |
| G5H8H1 | 28-177 | CGMNCYYHPTEPAVARCTRCGKGVCSQCIRYSGEAVVCPACDRTGQTEGLFYYLKYVILYVALFCIGYELDFMSSETVRHSPYESGY… |
| R7PAJ2 | 1-172 | None |
| A0A397RV14 | 22-189 | None |
| F3ZSV2 | 1-145 | None |
| A0A2D3JLB0 | 1-152 | None |
| A0A0F2PCC1 | 1-145 | None |
| R6KJY0 | 2-175 | None |
| A0A417NB21 | 1-147 | None |
| A0A6L3K5P9 | 2-174 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.