DPCstruct | MC25717
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 142 ± 10 aa |
| Standard deviation of domain lengths | 10.25 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 82.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 53.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10486 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2I4AXV0 | 13-161 | ESELYRSVQAALPRGSDQHQPTDLCNKGMLRWTLHKKVQNNPVNSLSLLWVLIKELEKAERWDSRKFIIPLLHTLMYAIVQTAYIPD… |
| A0A2Y9LA87 | 1-154 | MESSDAELDLQRSVQAVLRELSPHAPALQSNQGMWRWSLHKKVERDPGKSPVLVRILLRELEKAESEDLRHVIIPLLHTLLYVLTKA… |
| Q0IHV3 | 1-148 | None |
| A0A2K6P314 | 1-152 | None |
| A0A6P9AYE9 | 1-131 | None |
| L9JV47 | 35-173 | None |
| A0A6G0J8B6 | 16-163 | None |
| A0A674PEL0 | 7-130 | None |
| A0A5J5DP59 | 28-155 | None |
| A0A4Z2H182 | 1-148 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.