DPCstruct | MC25716
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 388 ± 96 aa |
| Standard deviation of domain lengths | 95.61 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 71.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 19.33 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07773 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S7ELE7 | 37-363 | FLKNFKVECITRFHSCPTGPPLKTWQKDLSIDVLNGQGGVVKVNLTDDKTSDLFLSSGQGVRLRCKDMTLALDYKFYWKENGITNIS… |
| A0A2Y9KIV1 | 23-403 | TPAPAKYKYGAPLQTSDSFLRFPSPLMSSLCTDNNPAAFLVNQAVKCTRRINLEQCEKIEALGMAYYSSPKILRVPDLRTEAEIPVT… |
| A0A5B7CJ90 | 157-627 | None |
| A0A0D2MRT6 | 21-472 | None |
| A0A7J6D3I9 | 256-670 | None |
| G0P2Y5 | 47-398 | None |
| A0A061SKF3 | 438-893 | None |
| A0A820XU72 | 1-340 | None |
| A0A0M3IK68 | 3-346 | None |
| A0A498NGC2 | 190-499 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.