DPCstruct | MC25715
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 84 ± 12 aa |
| Standard deviation of domain lengths | 12.28 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 92.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 36.32 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W0SPB9 | 21-91 | FSIDGTSVDISRIETPLYVVGAEKDHIVPWRGAYRTTQVVSGEARFALTSGGHIAGAVNPPGYPKAAFRTG |
| A0A126E9P0 | 1-95 | MLKESNNLEVLGTKIDLGKVDCNSFFVAAKEDHIAPWRSIYDGVKLLNGHKIFCLTDSGHVAGVVNPPASAKYNYRLNDYLSLSSHE… |
| A0A7Y6Z2B3 | 10-80 | None |
| A0A6G3VPI7 | 1-74 | None |
| J3GV52 | 139-227 | None |
| A0A1H6IQV8 | 23-96 | None |
| A0A6B1GJZ0 | 1-103 | None |
| A0A4P7LTD5 | 256-340 | None |
| A0A0B7J308 | 127-200 | None |
| A0A5C4VRT7 | 423-507 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.