DPCstruct | MC25714
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 113 ± 10 aa |
| Standard deviation of domain lengths | 10.03 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 34.32 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A126E8Q8 | 11-112 | GETFDISLILKYSDWAKMPKADPAFLKIHYGRDGKLNKLSLPNPPIIFYNQWYPALTVYKGELCSLPISSGYYRYLNKKILENNGSI… |
| A0A0F3MH25 | 686-797 | LSASVNGVTKTVTKHRTIDIPRAVEENKGPLDLALVAQDETGKNMSESKAVYLTAHYNQEGKLVEMTHPEPMKFFSDDPGSPAYTVI… |
| Q1RJ37 | 290-403 | None |
| A0A7V9PL15 | 617-731 | None |
| A0A0F3QJN0 | 2-118 | None |
| A0A0F3QGK5 | 35-148 | None |
| A0A7U0IYW8 | 262-377 | None |
| A0A816QTT5 | 60-180 | None |
| Q1RGU6 | 74-186 | None |
| A0A0F3QG48 | 220-336 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.