DPCstruct | MC25712
Metacluster Properties and Pfam Annotations
| Number of structural domains | 199 |
|---|---|
| Mean domain length (aa) | 71 ± 14 aa |
| Standard deviation of domain lengths | 13.62 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 84.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 21.90 |
| Pfam Score | 83.60 |
| Assigned Pfam label(s) | CL0039- CL0492- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3E0TRV1 | 4-73 | VYLVEIDQQPIELYKLLKIADLVSGGGEAKLLIAEGYVLLNNEIELQKRKKVYDGDFIQLGDNIIEVQFV |
| A0A126ZZ95 | 16-90 | QGSGAEETVEIREGTIRLGQLLKLASLVEDGVEAAELIRHGLVKVNGEIEERRGRQLGVGDSVEVNGQRVRLVPQ |
| H2G178 | 324-426 | None |
| A0A2H0T9W2 | 1-58 | None |
| A0A2W6V604 | 103-175 | None |
| A0A820APQ6 | 1-68 | None |
| A0A1V9Z361 | 514-615 | None |
| A0A6L5C4H1 | 1-65 | None |
| M7X241 | 249-351 | None |
| A0A5B9P8B8 | 9-74 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.