DPCstruct | MC25710
Metacluster Properties and Pfam Annotations
| Number of structural domains | 51 |
|---|---|
| Mean domain length (aa) | 128 ± 21 aa |
| Standard deviation of domain lengths | 20.97 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 81.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 15.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M9Z0Z1 | 9-144 | KQLVNVKTGEPYQPVRIYYQIFKNKKKTVLSALQKLKCIEYEPERDRWNWLYEAEAKKLRFTRSYGALTAADKPLILGYFTFRGEEQ… |
| A0A524A5A7 | 62-185 | NLEGLPAGKEPMFFSTAIFKIDDAESAMAKIERLRDVDLTDEDEEAAYYVWTRAYPKGHWNPMSNTPGARQIIGNIQVNFDNTLQLE… |
| A0A1F3B878 | 151-285 | None |
| A0A1W9TDJ1 | 197-326 | None |
| A0A0A2UT35 | 219-327 | None |
| A0A6N6Q2S3 | 3-112 | None |
| A0A521UJY5 | 94-213 | None |
| A8F1U9 | 2-134 | None |
| A0A849IK00 | 457-598 | None |
| A0A411YFM1 | 806-939 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.