DPCstruct | MC25709
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 125 ± 11 aa |
| Standard deviation of domain lengths | 11.13 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 35.70 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6H1ZGL1 | 672-789 | MSYRNDVRKIIKKKPGGAMFLAKLDAGMKVPDKEVTKYFTKAEQDRLFMTEFNKLIEEASKETDPSTGEYFTGDRLLERAAQKHYGG… |
| A0A6P0NGV6 | 1-111 | MSYRADVRAIISAKRGGSDFLTRMDKGYQTTPEELLSFFTEKEQDELFKLDQTRNIDQAIAEGMEGDRIIERVGQIHYGGPNSKIDG… |
| A0A0S3U6D7 | 1-130 | None |
| A0A846ASR9 | 36-153 | None |
| A0A1Z4I0G4 | 1-148 | None |
| A0A846EBM0 | 413-548 | None |
| A0A6P0YLH0 | 141-258 | None |
| A0A6M0S9S3 | 486-601 | None |
| A0A6P0X917 | 434-562 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.