DPCstruct | MC25706
Metacluster Properties and Pfam Annotations
| Number of structural domains | 2220 |
|---|---|
| Mean domain length (aa) | 295 ± 66 aa |
| Standard deviation of domain lengths | 66.42 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 85.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 18.29 |
| Pfam Score | 93.84 |
| Assigned Pfam label(s) | CL0052- PF11807- CL0159- CL0570- PF00067 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G8K8I3 | 2-159 | DWVADNHVKPAVASMSLGGGPSQSSDDAVTRMHNAGVTVVVAAGNDNEDASNHSPARAPLAITVASSASDDTRSSFSNFGSLIDIFA… |
| A0A7W0RC81 | 39-367 | DWLKVQWNFIGPAGVNAPDAWEAANAAGRPGGAGVTVAVLDTGVAYQSRGRYRRSPDFDLTRFVSGYDFVAGDKYPNDENGHGTHVT… |
| A0A7C1DRM0 | 4-159 | None |
| A0A2G1LPU8 | 13-254 | None |
| A0A7V7WNI6 | 11-259 | None |
| A0A1Q9C045 | 23-186 | None |
| A0A368PQ99 | 62-402 | None |
| I5D440 | 103-429 | None |
| A0A535AHM3 | 30-526 | None |
| A0A845DB92 | 106-305 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.