DPCstruct | MC25702
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 138 ± 13 aa |
| Standard deviation of domain lengths | 13.04 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 26.04 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0507 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X0IAZ9 | 27-152 | SSAVLDHAALSVAWAYFAKVYGDSLALRNAELFYLCAVRSLASALDDAKEQLSSNVLCATVLLGHFETFVNVSYAWIRHAGGAARLM… |
| A0A1V6N8W7 | 33-156 | LLAELPTKIQALEMSSAAVAASAMGHILNDQALVRQGLNYYIQGLQHLQKALWDPILMREDGTLAACMALSLYEALECPNLGSEGYF… |
| A0A420PIG2 | 118-247 | None |
| W9ZBW0 | 1-153 | None |
| A0A135LTT1 | 4-136 | None |
| B8NGR5 | 2-139 | None |
| A0A505IA63 | 482-644 | None |
| A0A072PF82 | 2-123 | None |
| A0A4Q7JL75 | 25-161 | None |
| A0A6A6WH23 | 111-246 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.