DPCstruct | MC2570
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 319 ± 27 aa |
| Standard deviation of domain lengths | 26.63 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 78.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 23.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A651G7Y9 | 54-387 | PLDARKRTILRAIVSEYVSRGEPVGSKRVVEVARLEVSAATVRNEMSALESLGYIAQPHTSAGRVPTDKGYRRFVDDLSADPALDGA… |
| A0A1A9YQS0 | 297-621 | LTQRQENILKVIVEEYTKTVQPVGSKAIMASPLIDSSSATIRNECAILEKEGFLEKEHASSGRIPSTRGYRYYVDNLMDEKNIDDIK… |
| A0A1G1I0Z6 | 4-338 | None |
| A0A432USL8 | 1-287 | None |
| A3RTC1 | 115-465 | None |
| A0A0J9TKI6 | 1-267 | None |
| A0A3M2DYT1 | 215-553 | None |
| A4C5M9 | 3-308 | None |
| A0A7Y5LDD0 | 175-458 | None |
| A0A538E3D3 | 476-810 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.