DPCstruct | MC257
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 93 ± 5 aa |
| Standard deviation of domain lengths | 4.96 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 83.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 34.83 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1A3NQF0 | 10-98 | DPSIARRFEEFHEANPKVYVVLVRLAREWVARTGRTKLGIKTLYERARWEIALATSDPDFKLNNNYTAYYARLIMHREPDLADMFDL… |
| A0A1I7IC85 | 1-99 | MSTTTIDHPTLDQKFQQYHQDNPHVYETLVRLARQMKARGHRRIGIKMLWETMRYQLMLDTLDPEGWKLNNNYPSRYARLIMSQEPD… |
| A0A0F9AHN5 | 11-102 | None |
| A0A350P3S0 | 11-97 | None |
| A0A661DQU7 | 18-115 | None |
| A0A1G3LFD7 | 21-113 | None |
| A0A812WH51 | 26-122 | None |
| A0A2S1YZU2 | 25-116 | None |
| A0A4R1BY95 | 12-108 | None |
| A0A0M4DN51 | 3-85 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.