DPCstruct | MC25696
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 114 ± 18 aa |
| Standard deviation of domain lengths | 17.50 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 77.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 37.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | CL0229- CL0027 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G0U1H9 | 357-485 | DKTISNESKRKMIIKLNCKTHSNEKIKRLSLKESEIPEFVKKEIEFFVTSRTLDFFKIFNLDTEFLLNDPSDWSENFSFQNAFKTIS… |
| A0A151IPD2 | 35-135 | KGLEFFVSSETKTFFRRFNLSTAFLYTDPLDWPENEEFKNELETVKKLKVVNDTAERAVKLIEDYNPCLTKNEEQKQFILQVVSDYR… |
| A0A4Y2UCD0 | 33-149 | None |
| S6D4N7 | 580-726 | None |
| A0A6G0ZDZ0 | 22-137 | None |
| J9JUW6 | 681-798 | None |
| J9K732 | 600-713 | None |
| A0A4Y2NDC6 | 113-235 | None |
| A0A7T8JZ46 | 14-111 | None |
| A0A7T8KDT6 | 3-84 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.