DPCstruct | MC25690
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 111 ± 8 aa |
| Standard deviation of domain lengths | 7.88 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 88.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 27.57 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1M3CGN1 | 6-117 | PPVCRIAEMYRTQPARLSFREELDGYLQHGYVFNTPTVFVMGRPVSRRASLEEIVDPWRVFAREEQDAWFLAALAGDWRSQLHLFPY… |
| R6J3F6 | 1-115 | MNALSAAFSYYLAAGRRVEEMEEDGRLQDVYIRTPELVLMARRVDSAAPFGKVVDVRFRFEPGRCDAWHLHFLAGDVRELLAYKREI… |
| A0A146GE88 | 1-113 | None |
| A0A4Q2XRK9 | 1-115 | None |
| A0A1T4Z3V3 | 1-115 | None |
| A0A2E8A9N9 | 5-93 | None |
| A0A1T4XZW0 | 23-132 | None |
| A0A1V5J367 | 11-126 | None |
| A0A2D7VYW0 | 14-121 | None |
| A0A2N8IJG4 | 31-148 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.