DPCstruct | MC2569
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 128 ± 21 aa |
| Standard deviation of domain lengths | 20.52 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 82.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 37.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A251TNK9 | 3-126 | ITEPSSESLTTSSKSELDPTRCITDGKYQQAIGMSIECRRLDKLREAITKSANVHATLSYCTDVSHAFVNRRQYRREVLLLVKVYQD… |
| A0A1S3DPT5 | 2-111 | RLEAIVNRIFDACLASKQYKEALGIALETRRMDVFEAAIKQCDDTSSILHYAFTLAMSSIQSRSFRAQILRTLVRLYHSLSVPDYVN… |
| A0A1Y3ECS7 | 554-727 | None |
| A0A2U1M557 | 62-186 | None |
| A0A0V1Q0K8 | 119-248 | None |
| B9RWJ0 | 131-263 | None |
| A0A183WU13 | 41-185 | None |
| J9BFR2 | 180-351 | None |
| A0A446J957 | 131-243 | None |
| A0A1B0A3S4 | 75-189 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.