DPCstruct | MC25688
Metacluster Properties and Pfam Annotations
| Number of structural domains | 148 |
|---|---|
| Mean domain length (aa) | 262 ± 73 aa |
| Standard deviation of domain lengths | 72.65 |
| Length coefficient of variation | 0.28 |
| Mean AlphaFold2 pLDDT confidence score | 77.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 20.12 |
| Pfam Score | 97.97 |
| Assigned Pfam label(s) | PF01594- PF03729 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C0X9R5 | 3-161 | RMFPRKVRNYAVEFLRDGYKQLRQYVVSLFIVAMIVGVTFWAFLMFMGVKYSILLGFWAALTNLIPIIGVVLEVIPILLTGISMGVS… |
| A0A7X8R2A2 | 36-296 | ITTLKSNMNVYLDSLNKFINDLADRYDLTGDIWNEISVNWNEIFNKSSKFVSAVIPQIYNFTKNLTNGIINIIIGIFVSIYLLAKKE… |
| A0A3D5A204 | 27-291 | None |
| A0A6L5C9U8 | 192-531 | None |
| A0A7V1XVE0 | 4-161 | None |
| G1VFG4 | 278-575 | None |
| B4CYM7 | 1-444 | None |
| A0A4P1KHV0 | 2-161 | None |
| A0A3L7W840 | 188-534 | None |
| A0A1B0BNT1 | 567-953 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.