DPCstruct | MC25683
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 64 ± 2 aa |
| Standard deviation of domain lengths | 2.10 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 94.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 52.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0617 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3R7DKX3 | 391-457 | TRYGVFTSRPEALTNDFFVNLLDPNTEWKAASDAKDLFVGHDRATGEPKWSGTRVDLIFGSNSEVRA |
| A0A7X4JQE0 | 392-454 | SPHGVFTDRPGTLTNDFFVNLLDLNTEWNATSTSQDVFEGRDSRTGALKWTGTRVDLALGSNS |
| A0A7K1AMW2 | 481-542 | None |
| A0A4V3HWL9 | 652-714 | None |
| A0A1H5X0R2 | 33-92 | None |
| A0A5Q3DX94 | 674-737 | None |
| A0A7Y8LS31 | 52-112 | None |
| A0A7K0Y628 | 100-164 | None |
| A0A520AE60 | 551-614 | None |
| A0A432VFP9 | 1019-1085 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.