DPCstruct | MC25673
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 274 ± 48 aa |
| Standard deviation of domain lengths | 47.55 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 74.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 22.57 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10332 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| P87236 | 1-267 | MGKLIRRTSLTSKIINLPIDYFIYVCEQFDSVEWDKVSDRYSIPFSLAVNFIFLLMRIYIKSTHVPVQRNQLFVDKQSINTSRSWFR… |
| A0A1J5WLQ1 | 2-217 | GFLFSAASAVFGGLDRVMCSLSREMVWGVSTVMGCLYVFIQLNKEECVSSGGSAELGVLSVVEILLWAVSALNVVFLFGKTERYQLF… |
| A0A1E3J1D3 | 130-447 | None |
| A0A507EIA3 | 1-332 | None |
| A0A423X1S2 | 2-293 | None |
| A0A6A5ZZB3 | 2-259 | None |
| W6MMK8 | 2-258 | None |
| A0A376B6W5 | 52-389 | None |
| A0A0J9XKQ6 | 1-367 | None |
| F0Z8U6 | 212-424 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.