DPCstruct | MC25672
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 287 ± 70 aa |
| Standard deviation of domain lengths | 70.30 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 86.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 24.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1J5WIB0 | 4-263 | ELVLDADCSVHITEILKTENCSIWIGKVKKIWLEGFAIQILPKLRFHRENEIYMFGLNIYNIHCITPVILGVENNSIWIGRVKSLEL… |
| A0A1J5WH23 | 241-568 | NKEYVSEIIHADDNSILLGKVKRLELKQFAINALPKLVLHKENVMDEFSLEAAKEEYVSEIIQADNNSIWLGKVKRLVLGGYAANAL… |
| A0A1J5WLT6 | 3-213 | None |
| A0A1J5WMX6 | 11-206 | None |
| A0A1J5WSI2 | 107-344 | None |
| A0A1J5WUB2 | 98-288 | None |
| A0A1J5WUR7 | 271-569 | None |
| A0A1J5WVJ3 | 52-383 | None |
| A0A1J5WW09 | 18-360 | None |
| A0A1J5WW48 | 285-638 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.