DPCstruct | MC2567
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 217 ± 24 aa |
| Standard deviation of domain lengths | 23.70 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 17.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11428 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7D7UGF6 | 32-274 | FYLSLIKMIKTDLDNKDYKKALLSIQEELDTDYLPLGLVDYFKQAHLVTKRLMYESEFDWLEKLDKKELINKTIVNFPDNLWYFDYL… |
| A0A291IRG4 | 1-256 | MPKWHDFFIPRKGELKVNFYEERLLELQKLIDQNEIEQALKLINEELSMPYVPKDFEDDLIKLRTRILVEKINNEEHHLSSDKIFSL… |
| A0A847X8C9 | 1-211 | None |
| A0A420Z2P6 | 1-192 | None |
| A0A1H0Y6R1 | 78-319 | None |
| A0A292III7 | 84-302 | None |
| A0A6G9HHL4 | 2-211 | None |
| A0A7X7Q2W3 | 77-278 | None |
| A0A645FJ67 | 1-181 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.