DPCstruct | MC25668
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 102 ± 6 aa |
| Standard deviation of domain lengths | 5.94 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 89.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 44.34 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A094G9J6 | 200-299 | LGESEQYWRRTDRPSERDQRQEERAAFPFRGDIDEPDAPPLAWTIIWYDTYSSLYGYYIPDEMRRCWYVFWDAATLEDNGGKRVLHK… |
| A0A1E3BTV1 | 137-238 | EVVLDETTQSIRRDEHPSDQDLKQERRDSLPFQGDSAELPPLAWTVIWHGTYSNLFGWYVKDPIRLWGYIMWDAARLEYTGARGLLV… |
| A0A2J6RTN0 | 295-389 | None |
| A0A124BUK3 | 404-498 | None |
| A0A428PJE5 | 111-208 | None |
| A0A1G4BK74 | 380-471 | None |
| A0A0G2FDF3 | 224-327 | None |
| A0A5C6TF34 | 177-288 | None |
| A0A146FP28 | 37-144 | None |
| A0A0F7ZLT0 | 17-122 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.