DPCstruct | MC25666
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 185 ± 28 aa |
| Standard deviation of domain lengths | 28.41 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 84.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.54 |
| Mean length-normalized TM-Score | 0.37 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 23.52 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0361 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1W2FVJ0 | 2-187 | AVGTVEREGDRVQCHLCERWFKSVTAHLSSHGWDHIAYREAFGLERGASLEGDATRKRRAALMRKRRVLDPAIRQGVQHGIEMARSG… |
| L7LQ52 | 48-258 | IFGDPSGHGLYGVLDDDGTTVLCHECGQRFESVGAHVGGAHGMSAAEYKARHGLARGTALISQASHQRRSEASKARLGSAGWRRFEA… |
| A0A7X7VUX1 | 25-271 | None |
| J0NKI4 | 1-145 | None |
| A0A2S9QPR8 | 194-383 | None |
| A0A0Q6USE8 | 1-201 | None |
| A0A2W6CK50 | 24-218 | None |
| A0A285EC08 | 1-167 | None |
| A0A2P7AFR7 | 69-242 | None |
| H0R5B5 | 4-165 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.