DPCstruct | MC25661
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 113 ± 15 aa |
| Standard deviation of domain lengths | 14.81 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 91.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 36.87 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2U3D7F1 | 91-202 | QIVELNRKDMIDLVALLLVAPLVETDQPSAINIRYLAKMLAKDWGLWRTCTKNLQLLVNEMCTLIADEMQQSKVLEKINTLQQAIDL… |
| A0A535FWF9 | 29-138 | QVFEVNMKDLVDTVALLLDHPISDQDGDAINAAYLGKLTAEDWGLHRTLQLNTARVRDAARALDVDAGRINQRLDELWMRIDAQPKS… |
| A0A355B0F8 | 269-417 | None |
| A0A367FR04 | 372-489 | None |
| A0A7V2E024 | 2-103 | None |
| T1AYA0 | 135-246 | None |
| A0A497EXT2 | 15-118 | None |
| A0A838JG94 | 45-153 | None |
| A0A7W1FTB2 | 1-93 | None |
| A0A523U0N0 | 140-252 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.