DPCstruct | MC25660
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 145 ± 17 aa |
| Standard deviation of domain lengths | 16.88 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 91.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 35.11 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0381 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A535FS84 | 1-127 | MLGDSTRVETPGYTPSERSISDTFDKIFANAPGCILIASFASLLSRVQLVIDTASRYERVLALVGRSMVNNVQMAIELGYLKMPAGM… |
| A0A6B8MAG3 | 456-594 | ICDSTNILREGDSFSESDVARVLRPLIAEAPGRVLVTTFASNVARLRAIAEAALACGRTVVVAGRAMDRVVQVARDCGYLDGLPGFH… |
| A0A6N9YDM3 | 2-158 | None |
| A0A554JDL5 | 464-605 | None |
| A0A0F6TDQ3 | 240-405 | None |
| A0A0D8XEE0 | 176-332 | None |
| T0DR00 | 1-144 | None |
| A0A6P5G820 | 216-349 | None |
| A0A0D3BFF6 | 299-432 | None |
| A0A6H0V339 | 161-323 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.