DPCstruct | MC2566
Metacluster Properties and Pfam Annotations
| Number of structural domains | 58 |
|---|---|
| Mean domain length (aa) | 316 ± 62 aa |
| Standard deviation of domain lengths | 61.54 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 76.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 23.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A815IYM5 | 1-217 | QNLWVTDEFKRVIQTRGESLDPFLRPARWILIYRNKHIILVSPFEANWLMGRLHDLYRKQSPGELLTTTLRLFLPRTRRDQSIIVNT… |
| A0A814CBB4 | 338-696 | TMKKNSISPNEKEENIDDRITLTDILRWVYENTQQTTWGGLHLWATQTVSKRLWDYGGSKKLLTQLLDEEQQRELEREQELEEERQQ… |
| A0A819N9Z0 | 87-385 | None |
| H0EN30 | 767-1140 | None |
| A0A4V5N538 | 21-266 | None |
| A0A194UXN9 | 17-336 | None |
| A0A821JKI2 | 411-793 | None |
| A0A7S2XKU8 | 4-248 | None |
| A0A395H8E7 | 49-393 | None |
| A0A5N5PQT2 | 1-325 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.