DPCstruct | MC25659
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 109 ± 15 aa |
| Standard deviation of domain lengths | 14.77 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 83.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 26.81 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X8YW16 | 4-91 | HYPAVRATGEASWAVRGIPGSDRLIEYEALLNKVLETAPVTTVCQYDVNLFDGRTILDVLRVHPVMISRGQLVRNPFYVAPDEFLAAG |
| A0A535FJE7 | 11-108 | QALREGWHAVRISIDMTWLAKDIATPEQVLKYEAASDAVFTFQNAPIIALMHYDHSKLLPSLVVEMLKLHPISVVGKYIKRNPYYLN… |
| A0A1F3T044 | 109-235 | None |
| A0A1H6BTX3 | 84-187 | None |
| A0A832A1Y4 | 127-268 | None |
| A0A842XI47 | 89-207 | None |
| A0A1F9B7P7 | 100-222 | None |
| A0A6P2E206 | 193-305 | None |
| A0A537YKS8 | 188-290 | None |
| A0A2W4EQU9 | 101-201 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.