DPCstruct | MC25654
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 155 ± 11 aa |
| Standard deviation of domain lengths | 10.99 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 83.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 28.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0EB02 | 1-159 | MSCAYHIGNQIQLICLAPHKCKFQRKLCGECLFEHEVDVKLYIAPIKKFQELVTQKLELSKPNNELELTAQILNFKTILSSTQNMLK… |
| A0EAS0 | 2-158 | YQCTHHPNCQVTTICIDSHQCNRKLCHICVYEHKSSKRPLPIELFQDRLTEKVNEYKLDDQQQQLTIKTILKSALSDIEERIRKLHQ… |
| Q22AY6 | 7-141 | None |
| A0C5X9 | 1-163 | None |
| A0BTA2 | 3-140 | None |
| A0C5L5 | 1-164 | None |
| A0D3M2 | 1-163 | None |
| A0DDJ7 | 1-162 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.