DPCstruct | MC25653
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 350 ± 34 aa |
| Standard deviation of domain lengths | 34.15 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 81.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 32.99 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14921 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0DMH4 | 1-400 | MFRITYLTKTLLTITIFLNIVISQTLDDIKSQIVNDWQSIALELVPNSQGDQVYPEYKRRQWNFTSDSEFTALIETFTDKSGSNKKL… |
| A0A340WRF3 | 453-855 | RLDGPWISTGCEVRPGPEFLTRSYTFYPSRLFRAYQFYYRDPSCREPAHSLLIKGKVRLRRASWVTRGATEADYHLHKVGVVFHSRS… |
| A0A7M5X9I6 | 45-434 | None |
| A0A1I8HGV7 | 1-364 | None |
| A0A3B3Z0F5 | 22-362 | None |
| A0A7J5Z656 | 40-357 | None |
| A0A498MVY0 | 472-806 | None |
| A0A673H0G0 | 62-361 | None |
| A0A1I8FA81 | 3-305 | None |
| A0A1I8I098 | 2-357 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.