DPCstruct | MC25646
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 225 ± 26 aa |
| Standard deviation of domain lengths | 25.73 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 75.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 24.20 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C2J084 | 1-243 | MDKKQLQVWFQNRRQRDRRATGTMDAAVFNDADLAGLPHQDPFEAPRVRADAADGWLNVADICTAAQADATTRSTCLRLLAGHGVVS… |
| A0A5N5L1A7 | 2-188 | RMSDYYLNATEICAAAGLSKSERARYRRLLQKRGVLDRESSWVPFQDGVFLSEAVNLIDDLKPLFTHAPIDLPEQGNYLLQGWTQLP… |
| A0A094FTG2 | 656-899 | None |
| U7PQL3 | 786-1027 | None |
| A0A0F7ZQ33 | 24-287 | None |
| A0A545UKJ9 | 7-194 | None |
| A0A2C6AF12 | 4-188 | None |
| A0A1B8DM50 | 2-224 | None |
| A0A167S3I6 | 929-1152 | None |
| A0A0D2A8W5 | 374-610 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.