DPCstruct | MC25645
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 262 ± 28 aa |
| Standard deviation of domain lengths | 27.79 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 78.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 20.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q2HF98 | 321-630 | LDKSDLAAETLFAEWHATVAYLAAHIIPGQLELTLVCDVHYAGVETAKVVLDSLHLLPRLKNCHIRLCGVREPRLQQLAQDAVLRAR… |
| A0A0C2ILC9 | 45-319 | DSTVAAAHVWGAALKTYPQDKPLLGLTVISDVGSVETAERVVAPLKRAVLPASRLRECTIRLGRRRRDFDLRAVAQQAILALTTGAD… |
| A0A6A6UF84 | 144-440 | None |
| A0A319CXR8 | 46-295 | None |
| A0A0C3CWW2 | 224-475 | None |
| Q2H6T7 | 41-301 | None |
| A0A1E3BEB0 | 21-252 | None |
| U1HNP3 | 212-426 | None |
| A0A7C8IRP6 | 112-399 | None |
| A0A318ZCN3 | 563-802 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.